PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G268700.2
Common NameB456_004G268700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 349aa    MW: 38604.8 Da    PI: 8.7868
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G268700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.9e-333488155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Gorai.004G268700.2 34 KPRLRWTVELHDRFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8763191IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-323189IPR009057Homeodomain-like
SuperFamilySSF466891.97E-163389IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-243489IPR006447Myb domain, plants
PfamPF002492.0E-73686IPR001005SANT/Myb domain
PfamPF143793.1E-22123162IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MFQPKKPSTM NSHHDNRPMC VQPDSGLVLT TDPKPRLRWT VELHDRFVDA VTQLGGPDKA  60
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEFNDHS IKDDLQRTSA SSSGMMARSM  120
NEMQMEVQRR LHEQLEVQRH LQLRIEAQGK YMQSILEKAC QTLAGENMAS AGGAAGGYKG  180
VGNHRGVLPH MDGAMKDNFG PTLNFPPFQD LNIYGGDQHL DIQHNVERSS PSLDGHFMSN  240
KRHGPYGGGG GTGKSPLIWS DELRLQDLGM APSCLGPQDD PFKTGVIQIG PPSIDTSGIG  300
KLESLSDIYD TKPGISNDGI DERKFELSPK PERPSPRRAP FQTERMNP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5795746e-60JX579574.1 Gossypium hirsutum clone NBRI_GE11842 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007022784.10.0Homeodomain-like superfamily protein isoform 1
SwissprotQ9SAK51e-116APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D2R4V20.0A0A0D2R4V2_G
STRINGVIT_19s0085g00890.t011e-164(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-102G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]